Recombinant Human Tryptase beta-2/TPSB2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Tryptase beta-2/TPSB2 Peptides and Proteins

Order Details


    • Catalog Number
      H00064499-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Tryptase beta-2/TPSB2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-275 of Human TPSB2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
TPSB2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tryptase beta-2/TPSB2 Protein

  • EC 3.4.21
  • EC 3.4.21.59
  • mast cell tryptase beta II
  • mast cell tryptase beta III
  • TPS2
  • TPS2tryptase beta-2
  • TPSB2
  • tryptase beta 2 (gene/pseudogene)
  • tryptase beta 2
  • tryptase beta II
  • tryptase beta III
  • Tryptase beta2
  • Tryptase beta-2
  • Tryptase II
  • tryptase III
  • tryptase-2
  • tryptaseB
  • tryptaseC
  • Tryptase-C

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26444
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31981
Species: Hu
Applications: IHC, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP1-31318
Species: Mu
Applications: IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB5074
Species: Hu
Applications: WB
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
MAB4099
Species: Hu
Applications: WB, IP

Publications for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01) (0)

There are no publications for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01) (0)

There are no reviews for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptase beta-2/TPSB2 Products

Bioinformatics Tool for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01)

Discover related pathways, diseases and genes to Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01)

Discover more about diseases related to Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01).
 

Pathways for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01)

View related products by pathway.

PTMs for Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01)

Learn more about PTMs related to Tryptase beta-2/TPSB2 Recombinant Protein (H00064499-P01).

Blogs on Tryptase beta-2/TPSB2

There are no specific blogs for Tryptase beta-2/TPSB2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tryptase beta-2/TPSB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSB2
Entrez