Recombinant Human Trypsin 2/PRSS2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Trypsin 2/PRSS2 Peptides and Proteins

Order Details


    • Catalog Number
      H00005645-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Trypsin 2/PRSS2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-247 of Human PRSS2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
PRSS2

Applications/Dilutions

Application Notes
This antibody is useful for ELISA and Western Blot. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Trypsin 2/PRSS2 Protein

  • Anionic trypsinogen
  • EC 3.4.21
  • EC 3.4.21.4
  • MGC111183
  • MGC120174
  • MGC120175
  • protease serine 2 preproprotein
  • protease, serine, 2 (trypsin 2)
  • protease, serine, 2, preproprotein
  • PRSS2
  • Serine protease 2
  • Tesp4
  • TRY2TRY8
  • TRY8
  • TRYP2
  • Trypsin 2
  • Trypsin II
  • trypsin-2
  • trypsinogen 2
  • Trypsinogen 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3848
Species: Hu
Applications: WB, IHC, IP
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBL1-17349
Species: Hu
AF1585
Species: Hu
Applications: WB, IP
AF2898
Species: Mu
Applications: WB, IP
AF3565
Species: Mu
Applications: WB, IHC, IP
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79670
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
AF6907
Species: Hu
Applications: WB, IHC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
H00005645-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01) (0)

There are no publications for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01) (0)

There are no reviews for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Trypsin 2/PRSS2 Products

Bioinformatics Tool for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01)

Discover related pathways, diseases and genes to Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01)

Discover more about diseases related to Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01).
 

Pathways for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01)

View related products by pathway.

PTMs for Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01)

Learn more about PTMs related to Trypsin 2/PRSS2 Recombinant Protein (H00005645-P01).

Blogs on Trypsin 2/PRSS2

There are no specific blogs for Trypsin 2/PRSS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Trypsin 2/PRSS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS2
Entrez