Trypsin 1/PRSS1 Antibody

Images

 
Western Blot: Trypsin 1/PRSS1 Antibody [H00005644-D01P] - Analysis of PRSS1 expression in human pancreas.
Western Blot: Trypsin 1/PRSS1 Antibody [H00005644-D01P] - Analysis of PRSS1 expression in transfected 293T cell line by PRSS1 polyclonal antibody.Lane 1: PRSS1 transfected lysate(26.60 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Trypsin 1/PRSS1 Antibody Summary

Immunogen
PRSS1 (NP_002760.1, 1 a.a. - 247 a.a.) full-length human protein. MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Specificity
Reacts with protease, serine, 1 (trypsin 1).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Trypsin 1/PRSS1 Antibody

  • Beta-trypsin
  • Cationic trypsinogen
  • digestive zymogen
  • DKFZp779A0837
  • EC 3.4.21
  • EC 3.4.21.4
  • FLJ57296
  • MGC120175
  • MGC149362
  • nonfunctional trypsin 1
  • protease, serine, 1 (trypsin 1)
  • PRSS1
  • PTRYI
  • Serine protease 1
  • TRP1
  • TRY1beta-trypsin
  • TRY4
  • Trygn16
  • TRYP1
  • Trypsin 1
  • Trypsin I
  • trypsin-1
  • Trypsinogen 1
  • trypsinogen A

Background

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
MAB3586
Species: Hu
Applications: WB, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008847-P01
Species: Hu
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1585
Species: Hu
Applications: WB, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
AF6907
Species: Hu
Applications: WB, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB

Publications for Trypsin 1/PRSS1 Antibody (H00005644-D01P) (0)

There are no publications for Trypsin 1/PRSS1 Antibody (H00005644-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trypsin 1/PRSS1 Antibody (H00005644-D01P) (0)

There are no reviews for Trypsin 1/PRSS1 Antibody (H00005644-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trypsin 1/PRSS1 Antibody (H00005644-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Trypsin 1/PRSS1 Products

Bioinformatics Tool for Trypsin 1/PRSS1 Antibody (H00005644-D01P)

Discover related pathways, diseases and genes to Trypsin 1/PRSS1 Antibody (H00005644-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trypsin 1/PRSS1 Antibody (H00005644-D01P)

Discover more about diseases related to Trypsin 1/PRSS1 Antibody (H00005644-D01P).
 

Pathways for Trypsin 1/PRSS1 Antibody (H00005644-D01P)

View related products by pathway.

PTMs for Trypsin 1/PRSS1 Antibody (H00005644-D01P)

Learn more about PTMs related to Trypsin 1/PRSS1 Antibody (H00005644-D01P).
 

Research Areas for Trypsin 1/PRSS1 Antibody (H00005644-D01P)

Find related products by research area.

Blogs on Trypsin 1/PRSS1

There are no specific blogs for Trypsin 1/PRSS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trypsin 1/PRSS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS1
Entrez
Uniprot