TRRAP Antibody


Immunocytochemistry/ Immunofluorescence: TRRAP Antibody [NBP1-87350] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: TRRAP Antibody [NBP1-87350] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Product Discontinued
View other related TRRAP Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRRAP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:KLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYRRQAWEVIKCFLVAMMSLEDNKHALYQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRRAP Antibody

  • 350/400 kDa PCAF-associated factor
  • FLJ10671
  • PAF350/400
  • PAF400
  • PAF400STAF40
  • STAF40
  • Tra1 homolog
  • Tra1
  • transformation/transcription domain-associated protein
  • TR-AP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu

Publications for TRRAP Antibody (NBP1-87350) (0)

There are no publications for TRRAP Antibody (NBP1-87350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRRAP Antibody (NBP1-87350) (0)

There are no reviews for TRRAP Antibody (NBP1-87350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRRAP Antibody (NBP1-87350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRRAP Products

Bioinformatics Tool for TRRAP Antibody (NBP1-87350)

Discover related pathways, diseases and genes to TRRAP Antibody (NBP1-87350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRRAP Antibody (NBP1-87350)

Discover more about diseases related to TRRAP Antibody (NBP1-87350).

Pathways for TRRAP Antibody (NBP1-87350)

View related products by pathway.

PTMs for TRRAP Antibody (NBP1-87350)

Learn more about PTMs related to TRRAP Antibody (NBP1-87350).

Research Areas for TRRAP Antibody (NBP1-87350)

Find related products by research area.

Blogs on TRRAP

There are no specific blogs for TRRAP, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRRAP Antibody and receive a gift card or discount.


Gene Symbol TRRAP