TRRAP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRRAP Antibody [NBP1-87350] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: TRRAP Antibody [NBP1-87350] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related TRRAP Primary Antibodies

Order Details


    • Catalog Number
      NBP1-87350
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRRAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYRRQAWEVIKCFLVAMMSLEDNKHALYQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRRAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRRAP Antibody

  • 350/400 kDa PCAF-associated factor
  • FLJ10671
  • PAF350/400
  • PAF400
  • PAF400STAF40
  • STAF40
  • Tra1 homolog
  • Tra1
  • transformation/transcription domain-associated protein
  • TR-AP
  • TRRAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBL1-11569
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu

Publications for TRRAP Antibody (NBP1-87350) (0)

There are no publications for TRRAP Antibody (NBP1-87350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRRAP Antibody (NBP1-87350) (0)

There are no reviews for TRRAP Antibody (NBP1-87350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRRAP Antibody (NBP1-87350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRRAP Products

Bioinformatics Tool for TRRAP Antibody (NBP1-87350)

Discover related pathways, diseases and genes to TRRAP Antibody (NBP1-87350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRRAP Antibody (NBP1-87350)

Discover more about diseases related to TRRAP Antibody (NBP1-87350).
 

Pathways for TRRAP Antibody (NBP1-87350)

View related products by pathway.

PTMs for TRRAP Antibody (NBP1-87350)

Learn more about PTMs related to TRRAP Antibody (NBP1-87350).
 

Research Areas for TRRAP Antibody (NBP1-87350)

Find related products by research area.

Blogs on TRRAP

There are no specific blogs for TRRAP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRRAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRRAP
Entrez