TRPM1 Antibody

Images

 
Western Blot: TRPM1 Antibody [NBP2-86010] - Host: Rabbit. Target Name: TRPM3. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Product Discontinued
View other related TRPM1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-86010
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRPM1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TRPM1. Peptide sequence: LRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TRPM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRPM1 Antibody

  • CSNB1C
  • Long transient receptor potential channel 1
  • LTrpC1
  • LTRPC1transient receptor potential cation channel subfamily M member 1
  • melastatin 1
  • melastatin-1
  • MLSN
  • MLSN1transient receptor potential melastatin family
  • transient receptor potential cation channel, subfamily M, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-48036
Species: Hu, Ca, Pm, Pm
Applications: WB, IHC, IHC-P
NB100-98867
Species: Rt
Applications: WB, IHC
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1617
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94226
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41262
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-86010
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for TRPM1 Antibody (NBP2-86010) (0)

There are no publications for TRPM1 Antibody (NBP2-86010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM1 Antibody (NBP2-86010) (0)

There are no reviews for TRPM1 Antibody (NBP2-86010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPM1 Antibody (NBP2-86010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRPM1 Products

Bioinformatics Tool for TRPM1 Antibody (NBP2-86010)

Discover related pathways, diseases and genes to TRPM1 Antibody (NBP2-86010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPM1 Antibody (NBP2-86010)

Discover more about diseases related to TRPM1 Antibody (NBP2-86010).
 

Pathways for TRPM1 Antibody (NBP2-86010)

View related products by pathway.

PTMs for TRPM1 Antibody (NBP2-86010)

Learn more about PTMs related to TRPM1 Antibody (NBP2-86010).

Blogs on TRPM1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM1