TRPA1 Antibody

Images

 
Immunohistochemistry: TRPA1 Antibody [NBP1-89075] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related TRPA1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89075
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRPA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAY
Specificity
Specificity of human TRPA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRPA1 Antibody

  • ANKTM1ankyrin-like with transmembrane domains 1
  • Ankyrin-like with transmembrane domains protein 1
  • Transformation-sensitive protein p120
  • transient receptor potential cation channel subfamily A member 1
  • transient receptor potential cation channel, subfamily A, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-145
Species: Hu, Mu, Dr
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12918
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-32096
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NB100-233
Species: Hu
Applications: WB, PLA
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1396
Species: Hu
Applications: WB
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-71805
Species: Hu
Applications: WB, IP
NBP1-89075
Species: Hu
Applications: IHC, IHC-P

Publications for TRPA1 Antibody (NBP1-89075) (0)

There are no publications for TRPA1 Antibody (NBP1-89075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPA1 Antibody (NBP1-89075) (0)

There are no reviews for TRPA1 Antibody (NBP1-89075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRPA1 Antibody (NBP1-89075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPA1 Products

Bioinformatics Tool for TRPA1 Antibody (NBP1-89075)

Discover related pathways, diseases and genes to TRPA1 Antibody (NBP1-89075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPA1 Antibody (NBP1-89075)

Discover more about diseases related to TRPA1 Antibody (NBP1-89075).
 

Pathways for TRPA1 Antibody (NBP1-89075)

View related products by pathway.

PTMs for TRPA1 Antibody (NBP1-89075)

Learn more about PTMs related to TRPA1 Antibody (NBP1-89075).
 

Research Areas for TRPA1 Antibody (NBP1-89075)

Find related products by research area.

Blogs on TRPA1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

TRPA1: A contributor to itching and inflammation? Scratch that!
Transient receptor potential A1 (TRPA1) is an ion channel found on the plasma membrane of many cell types that functions in diverse sensory processes such as pain and temperature. The TRPA1 ion channel is specifically expressed in nociceptive neurons,...  Read full blog post.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPA1