TRP7 Antibody

Images

 
Western Blot: TRP7 Antibody [NBP2-88490] - Host: Rabbit. Target Name: TRPC7. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRP7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRP7. Peptide sequence: EYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TRPC7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRP7 Antibody

  • hTRP7
  • KNP3
  • likley ortholog of mouse transient receptor potential cation channel, subfamilyC, member 7
  • putative capacitative calcium channel
  • short transient receptor potential channel 7
  • transient receptor potential cation channel, subfamily C, member 7
  • transient receptor potential-related channel 7, a novel putative Ca2+ channelprotein10TRPM2
  • Transient receptor protein 7
  • TRP7
  • TRP-7
  • TrpC7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-70352
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, IP, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-20989
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-12919
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, MiAr, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DCLU00
Species: Hu
Applications: ELISA
NBP1-86515
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-80537
Species: Mu
Applications: IHC, IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-45298
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-506
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-14868
Species: Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TRP7 Antibody (NBP2-88490) (0)

There are no publications for TRP7 Antibody (NBP2-88490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRP7 Antibody (NBP2-88490) (0)

There are no reviews for TRP7 Antibody (NBP2-88490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRP7 Antibody (NBP2-88490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRP7 Products

Array NBP2-88490

Bioinformatics Tool for TRP7 Antibody (NBP2-88490)

Discover related pathways, diseases and genes to TRP7 Antibody (NBP2-88490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRP7 Antibody (NBP2-88490)

Discover more about diseases related to TRP7 Antibody (NBP2-88490).
 

Pathways for TRP7 Antibody (NBP2-88490)

View related products by pathway.

PTMs for TRP7 Antibody (NBP2-88490)

Learn more about PTMs related to TRP7 Antibody (NBP2-88490).
 

Research Areas for TRP7 Antibody (NBP2-88490)

Find related products by research area.

Blogs on TRP7

There are no specific blogs for TRP7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPC7