TROY/TNFRSF19 Antibody (2G4)

Images

 
Western Blot: TROY/TNFRSF19 Antibody (2G4) [H00055504-M01] - TNFRSF19 monoclonal antibody (M01), clone 2G4 Analysis of TNFRSF19 expression in HepG2.
Western Blot: TROY/TNFRSF19 Antibody (2G4) [H00055504-M01] - Analysis of TNFRSF19 expression in transfected 293T cell line by TNFRSF19 monoclonal antibody (M01), clone 2G4.Lane 1: TNFRSF19 transfected lysate(45.3 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TROY/TNFRSF19 Antibody (2G4) Summary

Immunogen
TNFRSF19 (NP_061117, 30 a.a. ~ 120 a.a) partial recombinant protein with GST tag.ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQ CVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAI CGDCLP
Localization
Cell Membrane. Single-pass type I membrane protein.
Specificity
TNFRSF19 - tumor necrosis factor receptor superfamily, member 19
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFRSF19
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TROY/TNFRSF19 Antibody (2G4)

  • TAJ
  • TAJ-alpha
  • TAJToxicity and JNK inducer
  • TNFRSF19
  • TRADE
  • TROY
  • TROYtumor necrosis factor receptor superfamily member 19
  • tumor necrosis factor receptor superfamily, member 19

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3086
Species: Hu
Applications: WB, IHC
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3086
Species: Hu
Applications: WB, IHC
NBP2-26506
Species: Hu, Mu, Rt
AF745
Species: Mu
Applications: WB, Block
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF922
Species: Hu
Applications: WB, Block

Publications for TROY/TNFRSF19 Antibody (H00055504-M01) (0)

There are no publications for TROY/TNFRSF19 Antibody (H00055504-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROY/TNFRSF19 Antibody (H00055504-M01) (0)

There are no reviews for TROY/TNFRSF19 Antibody (H00055504-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TROY/TNFRSF19 Antibody (H00055504-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TROY/TNFRSF19 Products

Bioinformatics Tool for TROY/TNFRSF19 Antibody (H00055504-M01)

Discover related pathways, diseases and genes to TROY/TNFRSF19 Antibody (H00055504-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROY/TNFRSF19 Antibody (H00055504-M01)

Discover more about diseases related to TROY/TNFRSF19 Antibody (H00055504-M01).
 

Pathways for TROY/TNFRSF19 Antibody (H00055504-M01)

View related products by pathway.

PTMs for TROY/TNFRSF19 Antibody (H00055504-M01)

Learn more about PTMs related to TROY/TNFRSF19 Antibody (H00055504-M01).
 

Research Areas for TROY/TNFRSF19 Antibody (H00055504-M01)

Find related products by research area.

Blogs on TROY/TNFRSF19

There are no specific blogs for TROY/TNFRSF19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TROY/TNFRSF19 Antibody (2G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF19
Entrez
OMIM
Uniprot