TROVE2 Antibody (1F2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related TROVE2 Primary Antibodies

Order Details


    • Catalog Number
      H00006738-M03PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TROVE2 Antibody (1F2) [PE] Summary

Immunogen
TROVE2 (NP_004591, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
Specificity
TROVE2 (1F2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TROVE2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TROVE2 Antibody (1F2) [PE]

  • 60 kDa ribonucleoprotein Ro
  • 60 kDa Ro protein
  • 60 kDa SS-A/Ro ribonucleoprotein
  • Ro 60 kDa autoantigen
  • RO60gastric cancer multi-drug resistance protein
  • RORNP
  • Sjoegren syndrome antigen A2
  • Sjoegren syndrome type A antigen
  • Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro)
  • SS-A
  • SSA2Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro)
  • TROVE domain family member 2
  • TROVE domain family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006738-M03PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for TROVE2 Antibody (H00006738-M03PE) (0)

There are no publications for TROVE2 Antibody (H00006738-M03PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROVE2 Antibody (H00006738-M03PE) (0)

There are no reviews for TROVE2 Antibody (H00006738-M03PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TROVE2 Antibody (H00006738-M03PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TROVE2 Products

Bioinformatics Tool for TROVE2 Antibody (H00006738-M03PE)

Discover related pathways, diseases and genes to TROVE2 Antibody (H00006738-M03PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROVE2 Antibody (H00006738-M03PE)

Discover more about diseases related to TROVE2 Antibody (H00006738-M03PE).
 

Pathways for TROVE2 Antibody (H00006738-M03PE)

View related products by pathway.

PTMs for TROVE2 Antibody (H00006738-M03PE)

Learn more about PTMs related to TROVE2 Antibody (H00006738-M03PE).

Blogs on TROVE2

There are no specific blogs for TROVE2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TROVE2 Antibody (1F2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol TROVE2