Troponin T Type 2 (cardiac) Antibody


Western Blot: Troponin T Type 2 (cardiac) Antibody [NBP1-52885] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Troponin T Type 2 (cardiac) Antibody Summary

Synthetic peptides corresponding to Troponin T Type 2 (cardiac) The peptide sequence was selected from the N terminal of Troponin T Type 2 (cardiac). Peptide sequence ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Troponin T Type 2 (cardiac) and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Troponin T Type 2 (cardiac) Antibody

  • cardiac
  • CMD1D
  • CMPD2
  • dilated 1D (autosomal dominant)
  • hypertrophic 2
  • MGC3889
  • RCM3
  • TnTc
  • troponin T type 2 (cardiac)
  • troponin T, cardiac muscle


Troponin T Type 2 (cardiac) is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Troponin T Type 2 (cardiac) Antibody (NBP1-52885) (0)

There are no publications for Troponin T Type 2 (cardiac) Antibody (NBP1-52885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Troponin T Type 2 (cardiac) Antibody (NBP1-52885) (0)

There are no reviews for Troponin T Type 2 (cardiac) Antibody (NBP1-52885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Troponin T Type 2 (cardiac) Antibody (NBP1-52885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Troponin T Type 2 (cardiac) Products

Bioinformatics Tool for Troponin T Type 2 (cardiac) Antibody (NBP1-52885)

Discover related pathways, diseases and genes to Troponin T Type 2 (cardiac) Antibody (NBP1-52885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Troponin T Type 2 (cardiac) Antibody (NBP1-52885)

Discover more about diseases related to Troponin T Type 2 (cardiac) Antibody (NBP1-52885).

Pathways for Troponin T Type 2 (cardiac) Antibody (NBP1-52885)

View related products by pathway.

PTMs for Troponin T Type 2 (cardiac) Antibody (NBP1-52885)

Learn more about PTMs related to Troponin T Type 2 (cardiac) Antibody (NBP1-52885).

Research Areas for Troponin T Type 2 (cardiac) Antibody (NBP1-52885)

Find related products by research area.

Blogs on Troponin T Type 2 (cardiac)

There are no specific blogs for Troponin T Type 2 (cardiac), but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Troponin T Type 2 (cardiac) Antibody and receive a gift card or discount.


Gene Symbol TNNT2