Troponin I Type 3 (cardiac) Antibody (1E7.) [DyLight 680]

Images

 

Order Details


    • Catalog Number
      H00007137-M04FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Troponin I Type 3 (cardiac) Antibody (1E7.) [DyLight 680] Summary

Immunogen
TNNI3 (NP_000354, 102 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
Specificity
TNNI3 - troponin I type 3 (cardiac)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNNI3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Troponin I Type 3 (cardiac) Antibody (1E7.) [DyLight 680]

  • Cardiac troponin I
  • CMD1FF
  • CMD2A
  • CMH7MGC116817
  • cTnI
  • familial hypertrophic cardiomyopathy 7
  • RCM1
  • TNNC1troponin I, cardiac
  • troponin I type 3 (cardiac)
  • troponin I, cardiac muscle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF7439
Species: Hu
Applications: WB, IHC

Publications for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR) (0)

There are no publications for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR) (0)

There are no reviews for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Troponin I Type 3 (cardiac) Products

Bioinformatics Tool for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR)

Discover related pathways, diseases and genes to Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR)

Discover more about diseases related to Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR).
 

Pathways for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR)

View related products by pathway.

PTMs for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR)

Learn more about PTMs related to Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR).
 

Research Areas for Troponin I Type 3 (cardiac) Antibody (H00007137-M04FR)

Find related products by research area.

Blogs on Troponin I Type 3 (cardiac).

Troponin I Type 3 (TnI, cardiac)
Troponin I is part of a heteromeric thin filament regulatory complex that governs skeletal and cardiac muscle contraction. Troponin I is composed of three subunits: troponin I (TnI), troponin T (TnT), and troponin C (TnC), and each of these components...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Troponin I Type 3 (cardiac) Antibody (1E7.) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNI3