Troponin I type 2 (fast skeletal) Antibody

Images

 
Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. ...read more
Immunocytochemistry/ Immunofluorescence: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human cell line hTCEpi shows localization to plasma membrane. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNI2 antibody. Corresponding ...read more
Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human skeletal muscle shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Troponin I type 2 (fast skeletal) Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK
Specificity
Specificity of human Troponin I type 2 (fast skeletal) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNNI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Troponin I type 2 (fast skeletal) Antibody

  • skeletal, fast
  • troponin I type 2 (skeletal, fast)
  • troponin I, fast skeletal muscle
  • Troponin I, fast-twitch isoform
  • troponin I, fast-twitch skeletal muscle isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57612
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh, Ze
Applications: WB, IHC, IHC-P
NBP1-92534
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56641
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35336
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
NBP2-41309
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87752
Species: Hu
Applications: IHC, IHC-P
NBP2-27152
Species: Mu
Applications: WB
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
NBP2-38855
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775) (0)

There are no publications for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775) (0)

There are no reviews for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Troponin I type 2 (fast skeletal) Products

Bioinformatics Tool for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775)

Discover related pathways, diseases and genes to Troponin I type 2 (fast skeletal) Antibody (NBP2-38775). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775)

Discover more about diseases related to Troponin I type 2 (fast skeletal) Antibody (NBP2-38775).
 

Pathways for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775)

View related products by pathway.

Blogs on Troponin I type 2 (fast skeletal).

Troponin I Type 2 - I stay with fast-twitch skeletal muscles only
The protein Troponin I is a component of the heteromeric protein complex responsible for regulating both skeletal and cardiac muscle contraction. Troponin complex is made up of three parts: troponin I (TnI), troponin T (TnT), and troponin C (TnC). Eac...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Troponin I type 2 (fast skeletal) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNI2
Uniprot