tropomyosin-4 Antibody (4E4-1D2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related tropomyosin-4 Primary Antibodies

Order Details


    • Catalog Number
      H00007171-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

tropomyosin-4 Antibody (4E4-1D2) [PE] Summary

Immunogen
TPM4 (AAH37576, 1 a.a. - 248 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
Specificity
TPM4 - tropomyosin 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPM4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for tropomyosin-4 Antibody (4E4-1D2) [PE]

  • TM30p1
  • tropomyosin 4
  • tropomyosin alpha-4 chain
  • tropomyosin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32770
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB600-936
Species: Hu, Mu, Rt, Po, Bv, Ch, ChHa, In, Pm, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for tropomyosin-4 Antibody (H00007171-M01PE) (0)

There are no publications for tropomyosin-4 Antibody (H00007171-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for tropomyosin-4 Antibody (H00007171-M01PE) (0)

There are no reviews for tropomyosin-4 Antibody (H00007171-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for tropomyosin-4 Antibody (H00007171-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional tropomyosin-4 Products

Bioinformatics Tool for tropomyosin-4 Antibody (H00007171-M01PE)

Discover related pathways, diseases and genes to tropomyosin-4 Antibody (H00007171-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for tropomyosin-4 Antibody (H00007171-M01PE)

Discover more about diseases related to tropomyosin-4 Antibody (H00007171-M01PE).
 

Pathways for tropomyosin-4 Antibody (H00007171-M01PE)

View related products by pathway.

PTMs for tropomyosin-4 Antibody (H00007171-M01PE)

Learn more about PTMs related to tropomyosin-4 Antibody (H00007171-M01PE).

Blogs on tropomyosin-4

There are no specific blogs for tropomyosin-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our tropomyosin-4 Antibody (4E4-1D2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol TPM4