Recombinant Human TROAP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TROAP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 181-280 of Human TROAP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RLDPARASCFSRLEGPGPRGRTLCPQRLQALISPSGPSFHPSTHPSFQELRRETAGSSRTSVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TROAP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TROAP Protein

  • TASTIN
  • trophinin assisting protein
  • trophinin associated protein (tastin)
  • trophinin-assisting protein (tastin)
  • Trophinin-assisting protein
  • Trophinin-associated protein

Background

TROAP - trophinin associated protein (tastin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89501
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58739
Species: Hu
Applications: ICC/IF
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-58497
Species: Hu
Applications: WB, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TROAP Partial Recombinant Protein (H00010024-Q01) (0)

There are no publications for TROAP Partial Recombinant Protein (H00010024-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROAP Partial Recombinant Protein (H00010024-Q01) (0)

There are no reviews for TROAP Partial Recombinant Protein (H00010024-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TROAP Partial Recombinant Protein (H00010024-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TROAP Products

Bioinformatics Tool for TROAP Partial Recombinant Protein (H00010024-Q01)

Discover related pathways, diseases and genes to TROAP Partial Recombinant Protein (H00010024-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROAP Partial Recombinant Protein (H00010024-Q01)

Discover more about diseases related to TROAP Partial Recombinant Protein (H00010024-Q01).
 

Pathways for TROAP Partial Recombinant Protein (H00010024-Q01)

View related products by pathway.

PTMs for TROAP Partial Recombinant Protein (H00010024-Q01)

Learn more about PTMs related to TROAP Partial Recombinant Protein (H00010024-Q01).

Blogs on TROAP

There are no specific blogs for TROAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605
TROAP Antibody
NBP1-92532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TROAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TROAP