TRMT5 Antibody

Images

 
Western Blot: TRMT5 Antibody [NBP2-86005] - Host: Rabbit. Target Name: TRMT5. Sample Tissue: Human LN18 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRMT5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRMT5. Peptide sequence: QMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRMT5 Antibody

  • KIAA1393EC 2.1.1.31
  • M1G-methyltransferase
  • TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)
  • TRM5MGC111453
  • tRNA (guanine-N(1)-)-methyltransferase
  • tRNA [GM37] methyltransferase
  • tRNA methyltransferase 5
  • tRNA-N1G37 methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13486
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94200
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-76585
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20710
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-20772
Species: Hu
Applications: ICC/IF, WB
DIP100
Species: Hu
Applications: ELISA
NBP2-46016
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, WB
NBP2-27464
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-83633
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20030
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80406
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
H00009097-M04
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-88492
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59693
Species: Hu
Applications: IP, WB
NBP2-86005
Species: Hu
Applications: WB

Publications for TRMT5 Antibody (NBP2-86005) (0)

There are no publications for TRMT5 Antibody (NBP2-86005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMT5 Antibody (NBP2-86005) (0)

There are no reviews for TRMT5 Antibody (NBP2-86005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRMT5 Antibody (NBP2-86005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRMT5 Products

Bioinformatics Tool for TRMT5 Antibody (NBP2-86005)

Discover related pathways, diseases and genes to TRMT5 Antibody (NBP2-86005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TRMT5 Antibody (NBP2-86005)

View related products by pathway.

PTMs for TRMT5 Antibody (NBP2-86005)

Learn more about PTMs related to TRMT5 Antibody (NBP2-86005).

Blogs on TRMT5

There are no specific blogs for TRMT5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRMT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT5