TrkC Antibody (4D5)

Images

 
Immunocytochemistry/ Immunofluorescence: TrkC Antibody (4D5) [H00004916-M04] - Analysis of monoclonal antibody to NTRK3 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: TrkC Antibody (4D5) [H00004916-M04] - Detection limit for recombinant GST tagged NTRK3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
4D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TrkC Antibody (4D5) Summary

Immunogen
NTRK3 (AAH13693, 41 a.a. - 160 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQN
Specificity
NTRK3 - neurotrophic tyrosine kinase, receptor, type 3 (4D5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NTRK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TrkC Antibody (4D5)

  • EC 2.7.10
  • EC 2.7.10.1
  • ETS related protein-neurotrophic receptor tyrosine kinase fusion protein
  • ETV6-NTRK3 fusion
  • gp145(trkC)
  • GP145-TrkC
  • Neurotrophic tyrosine kinase receptor type 3
  • neurotrophic tyrosine kinase, receptor, type 3
  • NT 3 receptor
  • NT-3 growth factor receptor
  • NTRK3
  • TrkC tyrosine kinase
  • TrkC
  • trk-C
  • TRKCneurotrophin 3 receptor
  • tyrosine kinase receptor C

Background

This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-303-NA
Species: Hu
Applications: WB, Neut
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block

Publications for TrkC Antibody (H00004916-M04) (0)

There are no publications for TrkC Antibody (H00004916-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TrkC Antibody (H00004916-M04) (0)

There are no reviews for TrkC Antibody (H00004916-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TrkC Antibody (H00004916-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TrkC Products

Bioinformatics Tool for TrkC Antibody (H00004916-M04)

Discover related pathways, diseases and genes to TrkC Antibody (H00004916-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TrkC Antibody (H00004916-M04)

Discover more about diseases related to TrkC Antibody (H00004916-M04).
 

Pathways for TrkC Antibody (H00004916-M04)

View related products by pathway.

PTMs for TrkC Antibody (H00004916-M04)

Learn more about PTMs related to TrkC Antibody (H00004916-M04).
 

Research Areas for TrkC Antibody (H00004916-M04)

Find related products by research area.

Blogs on TrkC.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TrkC Antibody (4D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NTRK3
Entrez
Uniprot