TrkB Recombinant Protein Antigen

Images

 
There are currently no images for TrkB Recombinant Protein Antigen (NBP3-16988PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TrkB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TrkB

Source: E. coli

Amino Acid Sequence: INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NTRK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16988.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TrkB Recombinant Protein Antigen

  • BDNF/NT-3 growth factors receptor
  • EC 2.7.10
  • EC 2.7.10.1
  • GP145-TrkB
  • Neurotrophic tyrosine kinase receptor type 2
  • neurotrophic tyrosine kinase, receptor, type 2
  • NTRK2
  • TrkB tyrosine kinase
  • TrkB
  • trk-B
  • TRKBBDNF-tropomyosine receptor kinase B
  • tyrosine kinase receptor B

Background

TrkB is a tyrosine-protein kinase receptor involved in the development and/or maintenance of the nervous system. TrkB is a receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5, but not nerve growth factor (NGF). The major substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DBD00
Species: Hu
Applications: ELISA
AF1056
Species: Rt
Applications: IHC, WB
267-N3
Species: Hu
Applications: BA
268-N4
Species: Hu
Applications: BA
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1157
Species: Mu
Applications: IHC, WB
256-GF
Species: Hu
Applications: BA
AF-303-NA
Species: Hu
Applications: Neut, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB3468
Species: Hu
Applications: ICC, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
DRT200
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-16988PEP
Species: Hu
Applications: AC

Publications for TrkB Recombinant Protein Antigen (NBP3-16988PEP) (0)

There are no publications for TrkB Recombinant Protein Antigen (NBP3-16988PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TrkB Recombinant Protein Antigen (NBP3-16988PEP) (0)

There are no reviews for TrkB Recombinant Protein Antigen (NBP3-16988PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TrkB Recombinant Protein Antigen (NBP3-16988PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TrkB Products

Research Areas for TrkB Recombinant Protein Antigen (NBP3-16988PEP)

Find related products by research area.

Blogs on TrkB.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB and Nervous System Function
Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TrkB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NTRK2