TRIP6 Antibody (4B7) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related TRIP6 Primary Antibodies

Order Details


    • Catalog Number
      H00007205-M04FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRIP6 Antibody (4B7) [DyLight 680] Summary

Immunogen
TRIP6 (NP_003293, 51 a.a. - 148 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
Specificity
TRIP6 (4B7)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIP6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIP6 Antibody (4B7) [DyLight 680]

  • MGC10556
  • MGC10558
  • MGC29959
  • MGC3837
  • MGC4423
  • OIP1OIP-1
  • Opa-interacting protein 1
  • thyroid hormone receptor interactor 6
  • thyroid receptor-interacting protein 6
  • TR-interacting protein 6
  • ZRP-1TRIP-6
  • zyxin related protein 1
  • Zyxin-related protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for TRIP6 Antibody (H00007205-M04FR) (0)

There are no publications for TRIP6 Antibody (H00007205-M04FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIP6 Antibody (H00007205-M04FR) (0)

There are no reviews for TRIP6 Antibody (H00007205-M04FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIP6 Antibody (H00007205-M04FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIP6 Products

Bioinformatics Tool for TRIP6 Antibody (H00007205-M04FR)

Discover related pathways, diseases and genes to TRIP6 Antibody (H00007205-M04FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIP6 Antibody (H00007205-M04FR)

Discover more about diseases related to TRIP6 Antibody (H00007205-M04FR).
 

Pathways for TRIP6 Antibody (H00007205-M04FR)

View related products by pathway.

PTMs for TRIP6 Antibody (H00007205-M04FR)

Learn more about PTMs related to TRIP6 Antibody (H00007205-M04FR).
 

Research Areas for TRIP6 Antibody (H00007205-M04FR)

Find related products by research area.

Blogs on TRIP6

There are no specific blogs for TRIP6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIP6 Antibody (4B7) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP6