TRIM49B Antibody

Images

 
Western Blot: TRIM49B Antibody [NBP3-09223] - Western blot analysis of TRIM49B in A549 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM49B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TR49B. Peptide sequence CPIESAAEEHQEKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRL
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM49B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02434
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-88468
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
AF3468
Species: Hu
Applications: WB, Simple Western, ICC, KO
H00055521-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-74611
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP3-09223
Species: Hu
Applications: WB

Publications for TRIM49B Antibody (NBP3-09223) (0)

There are no publications for TRIM49B Antibody (NBP3-09223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM49B Antibody (NBP3-09223) (0)

There are no reviews for TRIM49B Antibody (NBP3-09223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM49B Antibody (NBP3-09223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIM49B Products

Array NBP3-09223

Bioinformatics Tool for TRIM49B Antibody (NBP3-09223)

Discover related pathways, diseases and genes to TRIM49B Antibody (NBP3-09223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TRIM49B

There are no specific blogs for TRIM49B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM49B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM49B