TRIM37 Antibody


Western Blot: TRIM37 Antibody [NBP1-53136] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related TRIM37 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRIM37 Antibody Summary

Synthetic peptides corresponding to TRIM37(tripartite motif-containing 37) The peptide sequence was selected from the middle region of TRIM37. Peptide sequence GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRIM37 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRIM37 Antibody

  • EC 6.3.2.-
  • KIAA0898Tripartite motif-containing protein 37
  • Mulibrey nanism protein
  • MULRING-B-box-coiled-coil protein
  • POB1E3 ubiquitin-protein ligase TRIM37
  • TEF3
  • tripartite motif containing 37
  • tripartite motif-containing 37


This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP

Publications for TRIM37 Antibody (NBP1-53136) (0)

There are no publications for TRIM37 Antibody (NBP1-53136).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM37 Antibody (NBP1-53136) (0)

There are no reviews for TRIM37 Antibody (NBP1-53136). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM37 Antibody (NBP1-53136) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRIM37 Products

Bioinformatics Tool for TRIM37 Antibody (NBP1-53136)

Discover related pathways, diseases and genes to TRIM37 Antibody (NBP1-53136). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM37 Antibody (NBP1-53136)

Discover more about diseases related to TRIM37 Antibody (NBP1-53136).

Pathways for TRIM37 Antibody (NBP1-53136)

View related products by pathway.

PTMs for TRIM37 Antibody (NBP1-53136)

Learn more about PTMs related to TRIM37 Antibody (NBP1-53136).

Research Areas for TRIM37 Antibody (NBP1-53136)

Find related products by research area.

Blogs on TRIM37

There are no specific blogs for TRIM37, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIM37 Antibody and receive a gift card or discount.


Gene Symbol TRIM37