Recombinant Human TRIM29 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TRIM29 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 488-588 of Human TRIM29

Source: Wheat Germ

Amino Acid Sequence: SSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIM29
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM29 Protein

  • Ataxia telangiectasia group D-associated protein
  • ATDC ataxia-telangiectasia group D-associated protein
  • ATDC
  • FLJ36085
  • tripartite motif containing 29
  • tripartite motif protein TRIM29
  • tripartite motif-containing 29
  • tripartite motif-containing protein 29

Background

The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus, it may act as a transcriptional regulatory factor involved in carcinogenesis and/or differentiation. It may also function in the suppression of radiosensitivity since it is associated with ataxia telangiectasia phenotype. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-00892
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-77563
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB7947
Species: Hu, Mu, Rt
Applications: IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92197
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM29 Partial Recombinant Protein (H00023650-Q01) (0)

There are no publications for TRIM29 Partial Recombinant Protein (H00023650-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM29 Partial Recombinant Protein (H00023650-Q01) (0)

There are no reviews for TRIM29 Partial Recombinant Protein (H00023650-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM29 Partial Recombinant Protein (H00023650-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM29 Products

Bioinformatics Tool for TRIM29 Partial Recombinant Protein (H00023650-Q01)

Discover related pathways, diseases and genes to TRIM29 Partial Recombinant Protein (H00023650-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM29 Partial Recombinant Protein (H00023650-Q01)

Discover more about diseases related to TRIM29 Partial Recombinant Protein (H00023650-Q01).
 

Pathways for TRIM29 Partial Recombinant Protein (H00023650-Q01)

View related products by pathway.

PTMs for TRIM29 Partial Recombinant Protein (H00023650-Q01)

Learn more about PTMs related to TRIM29 Partial Recombinant Protein (H00023650-Q01).

Blogs on TRIM29

There are no specific blogs for TRIM29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM29 Antibody
NBP1-88875
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM29 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM29