TRIM26 Recombinant Protein Antigen

Images

 
There are currently no images for TRIM26 Protein (NBP1-83910PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRIM26 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM26.

Source: E.coli

Amino Acid Sequence: FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83910.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TRIM26 Recombinant Protein Antigen

  • Acid finger protein
  • AFP
  • RNF95RING finger protein 95
  • tripartite motif containing 26
  • tripartite motif-containing protein 26
  • widely expressed acid zinc finger protein
  • Zinc finger protein 173
  • ZNF173tripartite motif-containing 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB4169
Species: Hu
Applications: WB, IHC
H00093659-P01
Species: Hu
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
930-ADB
Species: Hu
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83910PEP
Species: Hu
Applications: AC

Publications for TRIM26 Protein (NBP1-83910PEP) (0)

There are no publications for TRIM26 Protein (NBP1-83910PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM26 Protein (NBP1-83910PEP) (0)

There are no reviews for TRIM26 Protein (NBP1-83910PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TRIM26 Protein (NBP1-83910PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM26 Products

Bioinformatics Tool for TRIM26 Protein (NBP1-83910PEP)

Discover related pathways, diseases and genes to TRIM26 Protein (NBP1-83910PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM26 Protein (NBP1-83910PEP)

Discover more about diseases related to TRIM26 Protein (NBP1-83910PEP).
 

Pathways for TRIM26 Protein (NBP1-83910PEP)

View related products by pathway.

Research Areas for TRIM26 Protein (NBP1-83910PEP)

Find related products by research area.

Blogs on TRIM26

There are no specific blogs for TRIM26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM26 Antibody
NBP1-83910
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM26 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM26