Recombinant Human TRIM26 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIM26 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 146-240 of Human TRIM26 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIM26

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM26 Protein

  • Acid finger protein
  • AFP
  • RNF95RING finger protein 95
  • tripartite motif containing 26
  • tripartite motif-containing protein 26
  • widely expressed acid zinc finger protein
  • Zinc finger protein 173
  • ZNF173tripartite motif-containing 26

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB4169
Species: Hu
Applications: WB, IHC
H00093659-T01
Species: Hu
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
930-ADB
Species: Hu
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00007726-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for TRIM26 Partial Recombinant Protein (H00007726-Q02) (0)

There are no publications for TRIM26 Partial Recombinant Protein (H00007726-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM26 Partial Recombinant Protein (H00007726-Q02) (0)

There are no reviews for TRIM26 Partial Recombinant Protein (H00007726-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM26 Partial Recombinant Protein (H00007726-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM26 Products

Bioinformatics Tool for TRIM26 Partial Recombinant Protein (H00007726-Q02)

Discover related pathways, diseases and genes to TRIM26 Partial Recombinant Protein (H00007726-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM26 Partial Recombinant Protein (H00007726-Q02)

Discover more about diseases related to TRIM26 Partial Recombinant Protein (H00007726-Q02).
 

Pathways for TRIM26 Partial Recombinant Protein (H00007726-Q02)

View related products by pathway.

Research Areas for TRIM26 Partial Recombinant Protein (H00007726-Q02)

Find related products by research area.

Blogs on TRIM26

There are no specific blogs for TRIM26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM26 Antibody
NBP1-83910
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM26 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM26