Treacher Collins syndrome protein Antibody (8H3) [DyLight 680]



Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Treacher Collins syndrome protein Antibody (8H3) [DyLight 680] Summary

TCOF1 (NP_001008657, 2 a.a. - 82 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
Nucleus, nucleolus.
TCOF1 - Treacher Collins-Franceschetti syndrome 1
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Treacher Collins syndrome protein Antibody (8H3) [DyLight 680]

  • MFD1
  • nucleolar trafficking phosphoprotein
  • TCS1
  • Treacher Collins syndrome protein
  • Treacher Collins-Franceschetti syndrome 1
  • treacle protein
  • treacle


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, IP
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Treacher Collins syndrome protein Antibody (H00006949-M02FR) (0)

There are no publications for Treacher Collins syndrome protein Antibody (H00006949-M02FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Treacher Collins syndrome protein Antibody (H00006949-M02FR) (0)

There are no reviews for Treacher Collins syndrome protein Antibody (H00006949-M02FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Treacher Collins syndrome protein Antibody (H00006949-M02FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Treacher Collins syndrome protein Products

Bioinformatics Tool for Treacher Collins syndrome protein Antibody (H00006949-M02FR)

Discover related pathways, diseases and genes to Treacher Collins syndrome protein Antibody (H00006949-M02FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Treacher Collins syndrome protein Antibody (H00006949-M02FR)

Discover more about diseases related to Treacher Collins syndrome protein Antibody (H00006949-M02FR).

Pathways for Treacher Collins syndrome protein Antibody (H00006949-M02FR)

View related products by pathway.

PTMs for Treacher Collins syndrome protein Antibody (H00006949-M02FR)

Learn more about PTMs related to Treacher Collins syndrome protein Antibody (H00006949-M02FR).

Research Areas for Treacher Collins syndrome protein Antibody (H00006949-M02FR)

Find related products by research area.

Blogs on Treacher Collins syndrome protein

There are no specific blogs for Treacher Collins syndrome protein, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Treacher Collins syndrome protein Antibody (8H3) [DyLight 680] and receive a gift card or discount.


Gene Symbol TCOF1