TRBP Antibody (2H1)

Images

 
Western Blot: TRBP Antibody (2H1) [H00006895-M02] - TARBP2 monoclonal antibody (M02), clone 2H1. Analysis of TARBP2 expression in Jurkat.
Western Blot: TRBP Antibody (2H1) [H00006895-M02] - TARBP2 monoclonal antibody (M02), clone 2H1. Analysis of TARBP2 expression in human kidney.
Sandwich ELISA: TRBP Antibody (2H1) [H00006895-M02] - Detection limit for recombinant GST tagged TARBP2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRBP Antibody (2H1) Summary

Immunogen
TARBP2 (NP_599150 141 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG
Specificity
TARBP2 - Tar (HIV-1) RNA binding protein 2 (2H1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TARBP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRBP Antibody (2H1)

  • LOQS
  • RISC-loading complex subunit TARBP2
  • TAR (HIV) RNA binding protein 2
  • TAR (HIV) RNA-binding protein 2
  • TAR (HIV) RNA-binding protein TRBP1
  • TAR (HIV-1) RNA binding protein 2
  • TAR RNA binding protein 2
  • TAR RNA-binding protein 2
  • trans-activation responsive RNA-binding protein
  • Trans-activation-responsive RNA-binding protein
  • TRBP
  • TRBP1
  • TRBP2

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49535
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
H00000904-Q01
Species: Hu
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-80896
Species: Hu
Applications: IHC, IHC-P

Publications for TRBP Antibody (H00006895-M02) (0)

There are no publications for TRBP Antibody (H00006895-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRBP Antibody (H00006895-M02) (0)

There are no reviews for TRBP Antibody (H00006895-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRBP Antibody (H00006895-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRBP Products

Bioinformatics Tool for TRBP Antibody (H00006895-M02)

Discover related pathways, diseases and genes to TRBP Antibody (H00006895-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRBP Antibody (H00006895-M02)

Discover more about diseases related to TRBP Antibody (H00006895-M02).
 

Pathways for TRBP Antibody (H00006895-M02)

View related products by pathway.

PTMs for TRBP Antibody (H00006895-M02)

Learn more about PTMs related to TRBP Antibody (H00006895-M02).

Blogs on TRBP

There are no specific blogs for TRBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRBP Antibody (2H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol TARBP2
Entrez
Uniprot