Trappin-2/Elafin/Skalp Antibody

Images

 
Western Blot: SKALP Antibody [NBP1-69550] - This Anti-PI3 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related Trappin-2/Elafin/Skalp Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69550
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Trappin-2/Elafin/Skalp Antibody Summary

Immunogen
Synthetic peptides corresponding to PI3(peptidase inhibitor 3, skin-derived (SKALP)) The peptide sequence was selected from the middle region of PI3. Peptide sequence KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM.
Clonality
Polyclonal
Host
Rabbit
Gene
PI3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PI3 and was validated on Western blot.
Theoretical MW
6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Trappin-2/Elafin/Skalp Antibody

  • cementoin
  • Elafin
  • Elastase-specific inhibitor
  • ESI
  • ESIWAP four-disulfide core domain protein 14
  • Peptidase inhibitor 3
  • peptidase inhibitor 3, skin-derived
  • PI3
  • PI-3
  • pre-elafin
  • protease inhibitor 3, skin-derived (SKALP)
  • Protease inhibitor WAP3
  • SKALP
  • SKALPELAFIN
  • Skin-derived antileukoproteinase
  • Trappin2
  • Trappin-2
  • WAP four-disulfide core domain 14
  • WAP3MGC13613
  • WFDC14elafin

Background

PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.This gene encodes an elastase-specific inhibitor, which contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-69550
Species: Hu
Applications: WB

Publications for Trappin-2/Elafin/Skalp Antibody (NBP1-69550) (0)

There are no publications for Trappin-2/Elafin/Skalp Antibody (NBP1-69550).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trappin-2/Elafin/Skalp Antibody (NBP1-69550) (0)

There are no reviews for Trappin-2/Elafin/Skalp Antibody (NBP1-69550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trappin-2/Elafin/Skalp Antibody (NBP1-69550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Trappin-2/Elafin/Skalp Products

Bioinformatics Tool for Trappin-2/Elafin/Skalp Antibody (NBP1-69550)

Discover related pathways, diseases and genes to Trappin-2/Elafin/Skalp Antibody (NBP1-69550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trappin-2/Elafin/Skalp Antibody (NBP1-69550)

Discover more about diseases related to Trappin-2/Elafin/Skalp Antibody (NBP1-69550).
 

Pathways for Trappin-2/Elafin/Skalp Antibody (NBP1-69550)

View related products by pathway.

PTMs for Trappin-2/Elafin/Skalp Antibody (NBP1-69550)

Learn more about PTMs related to Trappin-2/Elafin/Skalp Antibody (NBP1-69550).

Blogs on Trappin-2/Elafin/Skalp

There are no specific blogs for Trappin-2/Elafin/Skalp, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trappin-2/Elafin/Skalp Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PI3
Entrez
Uniprot