Transketolase Antibody - BSA Free

Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in human cell lines A-549 and U2OS using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87442] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87442.

Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87442 (A) shows similar protein distribution across tissues to independent antibody NBP1-87441 (B).

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human testis.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human bone marrow using Anti-TKT antibody NBP1-87442.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Transketolase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Transketolase Antibody - BSA Free (NBP1-87442) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TKT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Transketolase Protein (NBP1-87442PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Transketolase Antibody - BSA Free

• EC 2.2.1.1
• FLJ34765
• TK
• TKT1
• transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TKT