Transketolase Antibody

Images

 
Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Transketolase Antibody [NBP1-87442] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Western Blot: Transketolase Antibody [NBP1-87442] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87442] - Staining of human kidney shows strong nuclear positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transketolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TKT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Transketolase Protein (NBP1-87442PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transketolase Antibody

  • EC 2.2.1.1
  • FLJ34765
  • TK
  • TKT1
  • transketolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87442
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Transketolase Antibody (NBP1-87442) (0)

There are no publications for Transketolase Antibody (NBP1-87442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Transketolase Antibody (NBP1-87442) (0)

There are no reviews for Transketolase Antibody (NBP1-87442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transketolase Antibody (NBP1-87442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transketolase Products

Bioinformatics Tool for Transketolase Antibody (NBP1-87442)

Discover related pathways, diseases and genes to Transketolase Antibody (NBP1-87442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transketolase Antibody (NBP1-87442)

Discover more about diseases related to Transketolase Antibody (NBP1-87442).
 

Pathways for Transketolase Antibody (NBP1-87442)

View related products by pathway.

PTMs for Transketolase Antibody (NBP1-87442)

Learn more about PTMs related to Transketolase Antibody (NBP1-87442).
 

Research Areas for Transketolase Antibody (NBP1-87442)

Find related products by research area.

Blogs on Transketolase

There are no specific blogs for Transketolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transketolase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TKT