TRANCE/TNFSF11/RANK L Antibody (3F7)

Images

 
Immunocytochemistry/ Immunofluorescence: TRANCE/TNFSF11/RANK L Antibody (3F7) [H00008600-M17] - Analysis of monoclonal antibody to TNFSF11 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: TRANCE/TNFSF11/RANK L Antibody (3F7) [H00008600-M17] - Detection limit for recombinant GST tagged TNFSF11 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRANCE/TNFSF11/RANK L Antibody (3F7) Summary

Immunogen
TNFSF11 (NP_003692.1 222 a.a. - 316 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI
Specificity
TNFSF11 - tumor necrosis factor (ligand) superfamily, member 11 (3F7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFSF11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRANCE/TNFSF11/RANK L Antibody (3F7)

  • CD254 antigen
  • CD254
  • ODF
  • OPGL
  • OPGLOPTB2
  • Osteoclast differentiation factor
  • Osteoprotegerin ligand
  • RANK L
  • RANKL
  • RANKLreceptor activator of nuclear factor kappa B ligand
  • Receptor activator of nuclear factor kappa-B ligand
  • sOdf
  • TNF-related activation-induced cytokine
  • TNFSF11
  • TRANCE
  • TRANCEODFhRANKL2
  • tumor necrosis factor (ligand) superfamily, member 11
  • tumor necrosis factor ligand superfamily member 11

Background

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP2-35213
Species: Hu
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17) (0)

There are no publications for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17) (0)

There are no reviews for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRANCE/TNFSF11/RANK L Products

Bioinformatics Tool for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17)

Discover related pathways, diseases and genes to TRANCE/TNFSF11/RANK L Antibody (H00008600-M17). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17)

Discover more about diseases related to TRANCE/TNFSF11/RANK L Antibody (H00008600-M17).
 

Pathways for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17)

View related products by pathway.

PTMs for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17)

Learn more about PTMs related to TRANCE/TNFSF11/RANK L Antibody (H00008600-M17).
 

Research Areas for TRANCE/TNFSF11/RANK L Antibody (H00008600-M17)

Find related products by research area.

Blogs on TRANCE/TNFSF11/RANK L.

The diverse functions of RANKL/TRANCE/TNFSF11
RANKL (also known as TNF-related activation-induced cytokine), or receptor activator of nuclear factor-?B ligand, was first discovered as a key player in the RANKL/RANK/OPG osteoclast formation pathway. Osteoclasts are large multinucleate cells t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRANCE/TNFSF11/RANK L Antibody (3F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF11
Entrez
Uniprot