TRAIL R2/TNFRSF10B Antibody

Images

 
Western Blot: TRAIL-R2 Antibody [NBP1-85772] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: TRAIL-R2 Antibody [NBP1-85772] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAIL R2/TNFRSF10B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF10B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRAIL R2/TNFRSF10B Protein (NBP1-85772PEP)
Publications
Read Publication using
NBP1-85772 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAIL R2/TNFRSF10B Antibody

  • CD262 antigen
  • CD262
  • death domain containing receptor for TRAIL/Apo-2L
  • Death receptor 5
  • DR5
  • DR5TRICK2B
  • Fas-like protein
  • KILLER/DR5
  • KILLERapoptosis inducing protein TRICK2A/2B
  • TNF-related apoptosis-inducing ligand receptor 2
  • TNFRSF10B
  • TRAIL R2
  • TRAIL receptor 2
  • TRAILR2
  • TRAIL-R2apoptosis inducing receptor TRAIL-R2
  • TRAILR2cytotoxic TRAIL receptor-2
  • TRICK2
  • TRICK2A
  • TRICKB
  • tumor necrosis factor receptor superfamily member 10B
  • tumor necrosis factor receptor superfamily, member 10b
  • tumor necrosis factor receptor-like protein ZTNFR9
  • ZTNFR9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6302
Species: Hu
Applications: Flow, CyTOF-ready
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for TRAIL R2/TNFRSF10B Antibody (NBP1-85772)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TRAIL R2/TNFRSF10B Antibody (NBP1-85772) (0)

There are no reviews for TRAIL R2/TNFRSF10B Antibody (NBP1-85772). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAIL R2/TNFRSF10B Antibody (NBP1-85772) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAIL R2/TNFRSF10B Products

Bioinformatics Tool for TRAIL R2/TNFRSF10B Antibody (NBP1-85772)

Discover related pathways, diseases and genes to TRAIL R2/TNFRSF10B Antibody (NBP1-85772). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAIL R2/TNFRSF10B Antibody (NBP1-85772)

Discover more about diseases related to TRAIL R2/TNFRSF10B Antibody (NBP1-85772).
 

Pathways for TRAIL R2/TNFRSF10B Antibody (NBP1-85772)

View related products by pathway.

PTMs for TRAIL R2/TNFRSF10B Antibody (NBP1-85772)

Learn more about PTMs related to TRAIL R2/TNFRSF10B Antibody (NBP1-85772).
 

Research Areas for TRAIL R2/TNFRSF10B Antibody (NBP1-85772)

Find related products by research area.

Blogs on TRAIL R2/TNFRSF10B

There are no specific blogs for TRAIL R2/TNFRSF10B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAIL R2/TNFRSF10B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF10B
Entrez