Recombinant Human TRAIL R1/TNFRSF10A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related TRAIL R1/TNFRSF10A Peptides and Proteins

Order Details


    • Catalog Number
      H00008797-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TRAIL R1/TNFRSF10A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 105-204 of Human TNFRSF10A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNFRSF10A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRAIL R1/TNFRSF10A Protein

  • APO2
  • CD261 antigen
  • CD261
  • cytotoxic TRAIL receptor
  • Death receptor 4
  • DR4 TRAIL receptor 1
  • DR4
  • TNF-related apoptosis inducing ligand receptor 1
  • TNF-related apoptosis-inducing ligand receptor 1
  • TNFRSF10A
  • TRAIL R1
  • TRAILR1
  • TRAIL-R1
  • TRAILR-1
  • TRAILR1MGC9365
  • tumor necrosis factor receptor superfamily member 10A
  • tumor necrosis factor receptor superfamily, member 10a

Background

TNFRSF10A - tumor necrosis factor receptor superfamily, member 10a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
MAB6302
Species: Hu
Applications: Flow, CyTOF-ready
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003125-B02P
Species: Hu
Applications: WB, Flow
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP

Publications for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01) (0)

There are no publications for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01) (0)

There are no reviews for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAIL R1/TNFRSF10A Products

Bioinformatics Tool for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01)

Discover related pathways, diseases and genes to TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01)

Discover more about diseases related to TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01).
 

Pathways for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01)

View related products by pathway.

PTMs for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01)

Learn more about PTMs related to TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01).
 

Research Areas for TRAIL R1/TNFRSF10A Partial Recombinant Protein (H00008797-Q01)

Find related products by research area.

Blogs on TRAIL R1/TNFRSF10A

There are no specific blogs for TRAIL R1/TNFRSF10A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRAIL R1/TNFRSF10A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF10A
Entrez