TRAIL R1/TNFRSF10A Antibody (2E9.)

Images

 
There are currently no images for TRAIL R1/TNFRSF10A Antibody (H00008797-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E9.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRAIL R1/TNFRSF10A Antibody (2E9.) Summary

Immunogen
TNFRSF10A (AAH12866, 105 a.a. - 204 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFRSF10A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRAIL R1/TNFRSF10A Antibody (2E9.)

  • APO2
  • CD261 antigen
  • CD261
  • cytotoxic TRAIL receptor
  • Death receptor 4
  • DR4 TRAIL receptor 1
  • DR4
  • TNF-related apoptosis inducing ligand receptor 1
  • TNF-related apoptosis-inducing ligand receptor 1
  • TNFRSF10A
  • TRAIL R1
  • TRAILR1
  • TRAIL-R1
  • TRAILR-1
  • TRAILR1MGC9365
  • tumor necrosis factor receptor superfamily member 10A
  • tumor necrosis factor receptor superfamily, member 10a

Background

Apoptosis, or programmed cell death, occurs during normal cellular differentiation and development of multicellular organisms. Apoptosis is induced by certain cytokines including TNF and Fas ligand of the TNF family through their death domain containing receptors, TNFR1 and Fas. A novel cell death receptor was recently identified and designated DR4 (for death receptor 4). The ligand for this novel death receptor has been identified and termed TRAIL, which is a new member in the TNF family. DR4 is also called TRAIL receptor 1(TRAIL R1). DR4 is expressed in most of human tissues including spleen, peripheral blood leukocytes, small intestine and thymus. Like TNFR1, Fas and DR3, DR4 mediates apoptosis and NF kB activation in many tissues and cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
MAB6302
Species: Hu
Applications: Flow, CyTOF-ready
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003125-B02P
Species: Hu
Applications: WB, Flow
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP

Publications for TRAIL R1/TNFRSF10A Antibody (H00008797-M02) (0)

There are no publications for TRAIL R1/TNFRSF10A Antibody (H00008797-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAIL R1/TNFRSF10A Antibody (H00008797-M02) (0)

There are no reviews for TRAIL R1/TNFRSF10A Antibody (H00008797-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAIL R1/TNFRSF10A Antibody (H00008797-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAIL R1/TNFRSF10A Products

Bioinformatics Tool for TRAIL R1/TNFRSF10A Antibody (H00008797-M02)

Discover related pathways, diseases and genes to TRAIL R1/TNFRSF10A Antibody (H00008797-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAIL R1/TNFRSF10A Antibody (H00008797-M02)

Discover more about diseases related to TRAIL R1/TNFRSF10A Antibody (H00008797-M02).
 

Pathways for TRAIL R1/TNFRSF10A Antibody (H00008797-M02)

View related products by pathway.

PTMs for TRAIL R1/TNFRSF10A Antibody (H00008797-M02)

Learn more about PTMs related to TRAIL R1/TNFRSF10A Antibody (H00008797-M02).
 

Research Areas for TRAIL R1/TNFRSF10A Antibody (H00008797-M02)

Find related products by research area.

Blogs on TRAIL R1/TNFRSF10A

There are no specific blogs for TRAIL R1/TNFRSF10A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAIL R1/TNFRSF10A Antibody (2E9.) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF10A
Entrez
Uniprot