TRAF3IP2 Antibody



Product Details

Product Discontinued
View other related TRAF3IP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRAF3IP2 Antibody Summary

Synthetic peptides corresponding to TRAF3IP2 (TRAF3 interacting protein 2) The peptide sequence was selected from the N terminal of TRAF3IP2. Peptide sequence IPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against TRAF3IP2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
65 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Applications: Func-Inh
Species: Hu
Applications: WB, Flow, Neut
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, AgAct
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB

Publications for TRAF3IP2 Antibody (NBP1-68908) (0)

There are no publications for TRAF3IP2 Antibody (NBP1-68908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF3IP2 Antibody (NBP1-68908) (0)

There are no reviews for TRAF3IP2 Antibody (NBP1-68908). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for TRAF3IP2 Antibody (NBP1-68908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF3IP2 Antibody Products

Related Products by Gene

Bioinformatics Tool for TRAF3IP2 Antibody (NBP1-68908)

Discover related pathways, diseases and genes to TRAF3IP2 Antibody (NBP1-68908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF3IP2 Antibody (NBP1-68908)

Discover more about diseases related to TRAF3IP2 Antibody (NBP1-68908).

Pathways for TRAF3IP2 Antibody (NBP1-68908)

View related products by pathway.

PTMs for TRAF3IP2 Antibody (NBP1-68908)

Learn more about PTMs related to TRAF3IP2 Antibody (NBP1-68908).

Blogs on TRAF3IP2

There are no specific blogs for TRAF3IP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol TRAF3IP2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-68908 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.