TRAF3IP2 Antibody


Western Blot: TRAF3IP2 Antibody [NBP1-68908] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Product Discontinued
View other related TRAF3IP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRAF3IP2 Antibody Summary

Synthetic peptides corresponding to TRAF3IP2 (TRAF3 interacting protein 2) The peptide sequence was selected from the N terminal of TRAF3IP2. Peptide sequence IPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRAF3IP2 and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRAF3IP2 Antibody

  • ACT1DKFZP586G0522
  • adapter protein CIKS
  • C6orf2
  • C6orf4chromosome 6 open reading frame 5
  • C6orf5DKFZp586G0522
  • C6orf6MGC3581
  • CIKSchromosome 6 open reading frame 2
  • Connection to IKK and SAPK/JNK
  • NFkB-activating protein ACT1
  • Nuclear factor NF-kappa-B activator 1
  • TRAF3 interacting protein 2
  • TRAF3-interacting protein 2


This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC

Publications for TRAF3IP2 Antibody (NBP1-68908) (0)

There are no publications for TRAF3IP2 Antibody (NBP1-68908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF3IP2 Antibody (NBP1-68908) (0)

There are no reviews for TRAF3IP2 Antibody (NBP1-68908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAF3IP2 Antibody (NBP1-68908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRAF3IP2 Products

Bioinformatics Tool for TRAF3IP2 Antibody (NBP1-68908)

Discover related pathways, diseases and genes to TRAF3IP2 Antibody (NBP1-68908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF3IP2 Antibody (NBP1-68908)

Discover more about diseases related to TRAF3IP2 Antibody (NBP1-68908).

Pathways for TRAF3IP2 Antibody (NBP1-68908)

View related products by pathway.

PTMs for TRAF3IP2 Antibody (NBP1-68908)

Learn more about PTMs related to TRAF3IP2 Antibody (NBP1-68908).

Research Areas for TRAF3IP2 Antibody (NBP1-68908)

Find related products by research area.

Blogs on TRAF3IP2

There are no specific blogs for TRAF3IP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRAF3IP2 Antibody and receive a gift card or discount.


Gene Symbol TRAF3IP2