TRADD Antibody (3G3)

Images

 
Immunoprecipitation: TRADD Antibody (3G3) [H00008717-M03] - Analysis of TRADD transfected lysate using anti-TRADD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRADD rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
3G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRADD Antibody (3G3) Summary

Immunogen
TRADD (NP_003780 203 a.a. - 312 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Specificity
TRADD (3G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRADD
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRADD Antibody (3G3)

  • MGC11078
  • TNFRSF1A-associated via death domainTNFR1-associated DEATH domain protein
  • TRADD
  • tumor necrosis factor receptor type 1 associated death domain protein
  • tumor necrosis factor receptor type 1-associated DEATH domain protein
  • tumor necrosis factor receptor-1-associated protein

Background

The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP

Publications for TRADD Antibody (H00008717-M03) (0)

There are no publications for TRADD Antibody (H00008717-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRADD Antibody (H00008717-M03) (0)

There are no reviews for TRADD Antibody (H00008717-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRADD Antibody (H00008717-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRADD Products

Bioinformatics Tool for TRADD Antibody (H00008717-M03)

Discover related pathways, diseases and genes to TRADD Antibody (H00008717-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRADD Antibody (H00008717-M03)

Discover more about diseases related to TRADD Antibody (H00008717-M03).
 

Pathways for TRADD Antibody (H00008717-M03)

View related products by pathway.

PTMs for TRADD Antibody (H00008717-M03)

Learn more about PTMs related to TRADD Antibody (H00008717-M03).
 

Research Areas for TRADD Antibody (H00008717-M03)

Find related products by research area.

Blogs on TRADD.

Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRADD Antibody (3G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRADD
Entrez
OMIM
Uniprot