Recombinant Human TR2/NR2C1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TR2/NR2C1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 17-124 of Human NR2C1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKASGRH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NR2C1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TR2/NR2C1 Protein

  • NR2C1
  • nuclear receptor subfamily 2 group C member 1
  • nuclear receptor subfamily 2, group C isoform
  • nuclear receptor subfamily 2, group C, member 1
  • Orphan nuclear receptor TR2
  • Testicular receptor 2
  • TR2 nuclear hormone receptor
  • TR2
  • TR2-11

Background

NR2C1 - nuclear receptor subfamily 2, group C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NLS5060
Species: Hu
Applications: WB, IHC-P
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF347
Species: Hu
Applications: WB, IHC, Neut
H00007181-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01) (0)

There are no publications for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01) (0)

There are no reviews for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TR2/NR2C1 Products

Bioinformatics Tool for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01)

Discover related pathways, diseases and genes to TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01)

Discover more about diseases related to TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01).
 

Pathways for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01)

View related products by pathway.

PTMs for TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01)

Learn more about PTMs related to TR2/NR2C1 Partial Recombinant Protein (H00007181-Q01).

Blogs on TR2/NR2C1

There are no specific blogs for TR2/NR2C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TR2/NR2C1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C1
Entrez