TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody

Images

 
Western Blot: Thyroid Hormone Receptor alpha Antibody [NBP1-74137] - Rat Muscle Lysate 1ug/ml Gel Concentration 12%

Order Details


    • Catalog Number
      NBP1-74137
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Thra. Immunizing peptide sequence MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL.
Clonality
Polyclonal
Host
Rabbit
Gene
THRA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Thra and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody

  • AR7
  • c-ERBA-1
  • c-erbA-alpha
  • EAR7
  • EAR-7
  • EAR-7.1/EAR-7.2
  • ERBA
  • ERBA1thyroid hormone receptor, alpha (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog)
  • ERBA-related 7
  • MGC000261
  • MGC43240
  • NR1A 1
  • NR1A1
  • NR1A1THRA3
  • Nuclear receptor subfamily 1 group A member 1
  • THRA
  • THRA1ERB-T-1
  • THRA2
  • thyroid hormone receptor alpha
  • thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a)oncogene homolog, avian)
  • TR alpha
  • triiodothyronine receptor
  • v-ErbA1
  • V-erbA-related protein 7

Background

Thra binds the promoter of the Na+/H+ exchanger NHE1 and mediates thyroid hormone induced transcriptional activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1670-SE
Species: Ec
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137) (0)

There are no publications for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137) (0)

There are no reviews for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TR alpha/NR1A1/Thyroid Hormone Receptor alpha Products

Bioinformatics Tool for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137)

Discover related pathways, diseases and genes to TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137)

Discover more about diseases related to TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137).
 

Pathways for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137)

View related products by pathway.

PTMs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137)

Learn more about PTMs related to TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody (NBP1-74137).

Blogs on TR alpha/NR1A1/Thyroid Hormone Receptor alpha

There are no specific blogs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THRA
Entrez
Uniprot