TPT1/TCTP Antibody (3C7) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related TPT1/TCTP Primary Antibodies

Order Details


    • Catalog Number
      H00007178-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TPT1/TCTP Antibody (3C7) [PE] Summary

Immunogen
TPT1 (AAH22436, 35 a.a. - 138 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Specificity
TPT1 - tumor protein, translationally-controlled 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPT1/TCTP Antibody (3C7) [PE]

  • FLJ27337
  • Fortilin
  • Histamine-releasing factor
  • HRF
  • p02
  • p23
  • TCTP
  • TCTPHRFfortilin
  • TPT1
  • translationally-controlled tumor protein
  • tumor protein, translationally-controlled 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4210
Species: Hu
Applications: WB, IHC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007178-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for TPT1/TCTP Antibody (H00007178-M01PE) (0)

There are no publications for TPT1/TCTP Antibody (H00007178-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPT1/TCTP Antibody (H00007178-M01PE) (0)

There are no reviews for TPT1/TCTP Antibody (H00007178-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TPT1/TCTP Antibody (H00007178-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPT1/TCTP Products

Bioinformatics Tool for TPT1/TCTP Antibody (H00007178-M01PE)

Discover related pathways, diseases and genes to TPT1/TCTP Antibody (H00007178-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPT1/TCTP Antibody (H00007178-M01PE)

Discover more about diseases related to TPT1/TCTP Antibody (H00007178-M01PE).
 

Pathways for TPT1/TCTP Antibody (H00007178-M01PE)

View related products by pathway.

PTMs for TPT1/TCTP Antibody (H00007178-M01PE)

Learn more about PTMs related to TPT1/TCTP Antibody (H00007178-M01PE).
 

Research Areas for TPT1/TCTP Antibody (H00007178-M01PE)

Find related products by research area.

Blogs on TPT1/TCTP

There are no specific blogs for TPT1/TCTP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPT1/TCTP Antibody (3C7) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol TPT1
Entrez