TPD52L1/D53 Antibody


Western Blot: TPD52L1/D53 Antibody [NBP1-84314] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MCF-7
Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84314] - Staining of human salivary gland shows distinct cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TPD52L1/D53 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Specificity of human TPD52L1/D53 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
TPD52L1/D53 Lysate (NBP2-65108)
Control Peptide
TPD52L1/D53 Protein (NBP1-84314PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TPD52L1/D53 Antibody

  • D53
  • MGC8556
  • tumor protein D52-like 1hD53TPD52L2
  • tumor protein D52-like 2
  • tumor protein D53


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TPD52L1/D53 Antibody (NBP1-84314) (0)

There are no publications for TPD52L1/D53 Antibody (NBP1-84314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52L1/D53 Antibody (NBP1-84314) (0)

There are no reviews for TPD52L1/D53 Antibody (NBP1-84314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPD52L1/D53 Antibody (NBP1-84314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TPD52L1/D53 Products

Bioinformatics Tool for TPD52L1/D53 Antibody (NBP1-84314)

Discover related pathways, diseases and genes to TPD52L1/D53 Antibody (NBP1-84314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPD52L1/D53 Antibody (NBP1-84314)

Discover more about diseases related to TPD52L1/D53 Antibody (NBP1-84314).

Pathways for TPD52L1/D53 Antibody (NBP1-84314)

View related products by pathway.

Blogs on TPD52L1/D53

There are no specific blogs for TPD52L1/D53, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TPD52L1/D53 Antibody and receive a gift card or discount.


Gene Symbol TPD52L1