TOR/mTOR Antibody (2C5)

Images

 
Sandwich ELISA: TOR/mTOR Antibody (2C5) [H00002475-M01] - Detection limit for recombinant GST tagged MTOR is approximately 3ng/ml as a capture antibody.
Proximity Ligation Assay: TOR/mTOR Antibody (2C5) [H00002475-M01] - Analysis of protein-protein interactions between AKT1 and MTOR. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MTOR ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, PLA
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TOR/mTOR Antibody (2C5) Summary

Immunogen
MTOR (NP_004949 1521 a.a. - 1620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
Specificity
FRAP1 - FK506 binding protein 12-rapamycin associated protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTOR
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOR/mTOR Antibody (2C5)

  • EC 2.7.11.1
  • FK506 binding protein 12-rapamycin associated protein 1
  • FK506 binding protein 12-rapamycin associated protein 2
  • FK506-binding protein 12-rapamycin complex-associated protein 1
  • FKBP12-rapamycin complex-associated protein
  • FLJ44809
  • FRAP
  • FRAP1
  • FRAP1FKBP12-rapamycin complex-associated protein 1
  • FRAP2
  • Mammalian target of rapamycin
  • mechanistic target of rapamycin (serine/threonine kinase)
  • Mechanistic target of rapamycin
  • MTOR
  • RAFT1
  • rapamycin and FKBP12 target 1
  • rapamycin associated protein FRAP2
  • Rapamycin target protein 1
  • RAPT1FKBP-rapamycin associated protein
  • serine/threonine-protein kinase mTOR
  • TOR

Background

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The CDT6 gene is located in an intron of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00002475-M01
Species: Hu
Applications: ELISA, PLA

Publications for TOR/mTOR Antibody (H00002475-M01) (0)

There are no publications for TOR/mTOR Antibody (H00002475-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOR/mTOR Antibody (H00002475-M01) (0)

There are no reviews for TOR/mTOR Antibody (H00002475-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TOR/mTOR Antibody (H00002475-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOR/mTOR Products

Bioinformatics Tool for TOR/mTOR Antibody (H00002475-M01)

Discover related pathways, diseases and genes to TOR/mTOR Antibody (H00002475-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOR/mTOR Antibody (H00002475-M01)

Discover more about diseases related to TOR/mTOR Antibody (H00002475-M01).
 

Pathways for TOR/mTOR Antibody (H00002475-M01)

View related products by pathway.

PTMs for TOR/mTOR Antibody (H00002475-M01)

Learn more about PTMs related to TOR/mTOR Antibody (H00002475-M01).
 

Research Areas for TOR/mTOR Antibody (H00002475-M01)

Find related products by research area.

Blogs on TOR/mTOR.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOR/mTOR Antibody (2C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTOR
Entrez
OMIM
Uniprot