TOP2A Antibody (1E2.) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related TOP2A Primary Antibodies

Order Details


    • Catalog Number
      H00007153-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TOP2A Antibody (1E2.) [DyLight 488] Summary

Immunogen
TOP2A (NP_001058 1435 a.a. - 1531 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Localization
Cytoplasmic and Nuclear; nucleoplasm. Note: Generally located in the nucleoplasm.
Specificity
TOP2A - topoisomerase (DNA) II alpha 170kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOP2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOP2A Antibody (1E2.) [DyLight 488]

  • DNA topoisomerase (ATP-hydrolyzing)
  • DNA topoisomerase 2-alpha
  • DNA topoisomerase II, 170 kD
  • DNA topoisomerase II, alpha isozyme
  • EC 5.99.1.3
  • TOP2
  • TOP2A
  • TOP2DNA gyrase
  • topoisomerase (DNA) II alpha (170kD)
  • topoisomerase (DNA) II alpha 170kDa
  • TP2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77222
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-89527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IF
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P

Publications for TOP2A Antibody (H00007153-M01G) (0)

There are no publications for TOP2A Antibody (H00007153-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOP2A Antibody (H00007153-M01G) (0)

There are no reviews for TOP2A Antibody (H00007153-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOP2A Antibody (H00007153-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOP2A Products

Bioinformatics Tool for TOP2A Antibody (H00007153-M01G)

Discover related pathways, diseases and genes to TOP2A Antibody (H00007153-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOP2A Antibody (H00007153-M01G)

Discover more about diseases related to TOP2A Antibody (H00007153-M01G).
 

Pathways for TOP2A Antibody (H00007153-M01G)

View related products by pathway.

PTMs for TOP2A Antibody (H00007153-M01G)

Learn more about PTMs related to TOP2A Antibody (H00007153-M01G).
 

Research Areas for TOP2A Antibody (H00007153-M01G)

Find related products by research area.

Blogs on TOP2A

There are no specific blogs for TOP2A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOP2A Antibody (1E2.) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP2A
Entrez