TNF-alpha Antibody (M2-E3)

Images

 
Sandwich ELISA: TNF-alpha Antibody (M2-E3) [H00007124-M04] - Detection limit for recombinant GST tagged TNF is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related TNF-alpha Primary Antibodies

Order Details


    • Catalog Number
      H00007124-M04
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TNF-alpha Antibody (M2-E3) Summary

Immunogen
TNF (AAH28148, 1 a.a. - 233 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Specificity
TNF - tumor necrosis factor (TNF superfamily, member 2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TNF-alpha Antibody (M2-E3)

  • APC1 protein
  • Cachectin
  • Cachetin
  • DIF
  • TNF
  • TNF, monocyte-derived
  • tnfa
  • tnf-a
  • TNFalpha
  • TNF-alpha
  • TNF-alphacachectin
  • TNFATNF, macrophage-derived
  • TNFSF1A
  • TNFSF2
  • TNFSF2TNF superfamily, member 2
  • tumor necrosis factor (TNF superfamily, member 2)
  • tumor necrosis factor alpha
  • Tumor necrosis factor ligand superfamily member 2
  • tumor necrosis factor
  • tumor necrosis factor-alpha

Background

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00007124-M04
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for TNF-alpha Antibody (H00007124-M04) (0)

There are no publications for TNF-alpha Antibody (H00007124-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNF-alpha Antibody (H00007124-M04) (0)

There are no reviews for TNF-alpha Antibody (H00007124-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNF-alpha Antibody (H00007124-M04). (Showing 1 - 4 of 4 FAQ).

  1. I need to know about TNF-alpha antibody kits for mice.
    • We currently have two TNFalpha ELISA kits specific for mouse: catalog numbers KA0257 and NBP1-92670.
  2. I would like to ask you for help. I need an antibody for Elisa to detect human TNF alpha in a supernatant from a cell culture (meaning supernatant after centrifugation of collected cell suspension from a plate well). Which of your antibodies against human tnf alpha would be suitable? I would like to buy only the primary antibody.
    • I would recommend catalog number NBP1-67821 or NB600-587; however, a full list of our anti-human TNF alpha antibodies suitable for use in ELISA can be found using this link.
  3. I am interested in a TNF alpha antibody, cross reactive for human, rat and mouse (host species: rabbit). Could your product NBP1-19532 be used in western blotting applications? Or do you have a similar product in your catalog which could fit with my request?
    • The antibody you mention, NBP1-19532, has not yet been validated in Western blot. I would instead recommend either NBP1-67821 or NB600-587. These are both rabbit polyclonal antibodies that cross-reacts with human, mouse and rat and have been used in Western blotting.
  4. Can your TNF-alpha products be used to treat TBI victims and therefore avoid the perispinal injections with Enbrel?
    • I am very sorry, but all of our products are for scientific research use only, and none are intended or approved for use in humans.

Secondary Antibodies

 

Isotype Controls

Additional TNF-alpha Products

Bioinformatics Tool for TNF-alpha Antibody (H00007124-M04)

Discover related pathways, diseases and genes to TNF-alpha Antibody (H00007124-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNF-alpha Antibody (H00007124-M04)

Discover more about diseases related to TNF-alpha Antibody (H00007124-M04).
 

Pathways for TNF-alpha Antibody (H00007124-M04)

View related products by pathway.

PTMs for TNF-alpha Antibody (H00007124-M04)

Learn more about PTMs related to TNF-alpha Antibody (H00007124-M04).
 

Research Areas for TNF-alpha Antibody (H00007124-M04)

Find related products by research area.

Blogs on TNF-alpha.

cIAP2 - balancing cell death and cell survival
The inhibitor of apoptosis proteins (IAPs) are important regulators of cell death and inflammation. The cellular inhibitor of apoptosis protein 2 (cIAP2) contains three Baculovirus IAP repeat (BIR) domains, a Ubiquitin associated (UBA) domain, and...  Read full blog post.

CD86 - I work in tandem with CD80
CD86 belongs to the immunoglobulin superfamily of proteins that drive innate and adaptive immune responses. It is an 80kD co-stimulatory molecule for the priming and activation of naive and memory T-cells, respectively. CD86 is expressed on activated...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNF-alpha Antibody (M2-E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNF
Entrez
OMIM
Uniprot