Recombinant Human TMPRSS2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMPRSS2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-492 of Human TMPRSS2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALNSGSPPAIEPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASDPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TMPRSS2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMPRSS2 Protein

  • EC 3.4.21
  • EC 3.4.21.109
  • FLJ41954
  • PP9284
  • PRSS10epitheliasin
  • Serine protease 10
  • transmembrane protease serine 2
  • transmembrane protease, serine 2
  • transmembrane protease, serine 2, EC 3.4.2110EC 3.4.21.-

Background

TMPRSS2( AAH51839, 1 a.a. - 493 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003249-P01
Species: Hu
Applications: WB
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00007113-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TMPRSS2 Recombinant Protein (H00007113-P01) (0)

There are no publications for TMPRSS2 Recombinant Protein (H00007113-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMPRSS2 Recombinant Protein (H00007113-P01) (0)

There are no reviews for TMPRSS2 Recombinant Protein (H00007113-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS2 Recombinant Protein (H00007113-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMPRSS2 Products

Bioinformatics Tool for TMPRSS2 Recombinant Protein (H00007113-P01)

Discover related pathways, diseases and genes to TMPRSS2 Recombinant Protein (H00007113-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMPRSS2 Recombinant Protein (H00007113-P01)

Discover more about diseases related to TMPRSS2 Recombinant Protein (H00007113-P01).
 

Pathways for TMPRSS2 Recombinant Protein (H00007113-P01)

View related products by pathway.

PTMs for TMPRSS2 Recombinant Protein (H00007113-P01)

Learn more about PTMs related to TMPRSS2 Recombinant Protein (H00007113-P01).
 

Research Areas for TMPRSS2 Recombinant Protein (H00007113-P01)

Find related products by research area.

Blogs on TMPRSS2

There are no specific blogs for TMPRSS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMPRSS2 Antibody
NBP2-38263

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMPRSS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS2