TMEM81 Antibody

Images

 
Western Blot: TMEM81 Antibody [NBP2-57182] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TMEM81 Antibody [NBP2-57182] - Staining of human cell line U-2 OS shows localization to actin filaments & intermediate filaments. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM81 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM81
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM81 Recombinant Protein Antigen (NBP2-57182PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TMEM81 Antibody

  • HC3107
  • KVLA2788
  • MGC75217
  • transmembrane protein 81
  • UNQ2788

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM81 Antibody (NBP2-57182) (0)

There are no publications for TMEM81 Antibody (NBP2-57182).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM81 Antibody (NBP2-57182) (0)

There are no reviews for TMEM81 Antibody (NBP2-57182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMEM81 Antibody (NBP2-57182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM81 Products

Bioinformatics Tool for TMEM81 Antibody (NBP2-57182)

Discover related pathways, diseases and genes to TMEM81 Antibody (NBP2-57182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM81

There are no specific blogs for TMEM81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM81 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM81