TMEM54 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM54 Antibody [NBP2-56844] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM54 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IAMTFATQGKALLAACTFGSSELLALAPDCPFD
Specificity
Specificity of human TMEM54 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM54
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TMEM54 Antibody

  • BCLP
  • Beta-casein-like protein
  • CAC1
  • CAC-1
  • MGC10137
  • Protein CAC-1
  • transmembrane protein 54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12553
Species: Hu
NBP1-54851
Species: Hu, Mu, Rt, Bv, Eq, GP, Rb, Ze
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
H00000810-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02024
Species: Hu
Applications: WB, Flow
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NLS3775
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-86690
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001513-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2628
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56844
Species: Hu
Applications: ICC/IF

Publications for TMEM54 Antibody (NBP2-56844) (0)

There are no publications for TMEM54 Antibody (NBP2-56844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM54 Antibody (NBP2-56844) (0)

There are no reviews for TMEM54 Antibody (NBP2-56844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM54 Antibody (NBP2-56844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM54 Products

Bioinformatics Tool for TMEM54 Antibody (NBP2-56844)

Discover related pathways, diseases and genes to TMEM54 Antibody (NBP2-56844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM54 Antibody (NBP2-56844)

Discover more about diseases related to TMEM54 Antibody (NBP2-56844).
 

Pathways for TMEM54 Antibody (NBP2-56844)

View related products by pathway.

Research Areas for TMEM54 Antibody (NBP2-56844)

Find related products by research area.

Blogs on TMEM54

There are no specific blogs for TMEM54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM54