TMEM225 Antibody


Immunohistochemistry: TMEM225 Antibody [NBP1-90679] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Product Discontinued
View other related TMEM225 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TMEM225 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:CKLSTSSCTCLNIHKSDNECKESENSIEDISLPERTAMPRSIVRAHTVNSLNKKVQTRHVTWAL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM225 Antibody

  • PMP22 claudin domain-containing protein
  • PMP22CD
  • transmembrane protein 225


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM225 Antibody (NBP1-90679) (0)

There are no publications for TMEM225 Antibody (NBP1-90679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM225 Antibody (NBP1-90679) (0)

There are no reviews for TMEM225 Antibody (NBP1-90679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM225 Antibody (NBP1-90679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM225 Products

TMEM225 NBP1-90679

Bioinformatics Tool for TMEM225 Antibody (NBP1-90679)

Discover related pathways, diseases and genes to TMEM225 Antibody (NBP1-90679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMEM225 Antibody (NBP1-90679)

View related products by pathway.

Blogs on TMEM225

There are no specific blogs for TMEM225, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM225 Antibody and receive a gift card or discount.


Gene Symbol TMEM225