TMEM114 Antibody

Images

 
Western Blot: TMEM114 Antibody [NBP3-09592] - Western blot analysis of TMEM114 in Fetal Brain lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM114 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM114 (NP_001139808). Peptide sequence GPGAQDLLGSINRSQPEPLSSHSGLWRTCRVQSPCTPLMNPFRLENVTVS
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM114
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TMEM114 Antibody

  • transmembrane protein 114

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-04895
Species: Hu, Mu, Rt
Applications: WB
NBP1-84375
Species: Hu
Applications: IHC, IHC-P, WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
AF3035
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
AF1979
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-33010
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-70450
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-46572
Species: Hu
Applications: IHC, WB
H00001415-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
NBP2-68576
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-32741
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, IF, IHC, WB
H00001412-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001419-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00001417-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-09592
Species: Hu
Applications: WB

Publications for TMEM114 Antibody (NBP3-09592) (0)

There are no publications for TMEM114 Antibody (NBP3-09592).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM114 Antibody (NBP3-09592) (0)

There are no reviews for TMEM114 Antibody (NBP3-09592). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM114 Antibody (NBP3-09592) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM114 Products

Array NBP3-09592

Bioinformatics Tool for TMEM114 Antibody (NBP3-09592)

Discover related pathways, diseases and genes to TMEM114 Antibody (NBP3-09592). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM114 Antibody (NBP3-09592)

Discover more about diseases related to TMEM114 Antibody (NBP3-09592).
 

Pathways for TMEM114 Antibody (NBP3-09592)

View related products by pathway.

PTMs for TMEM114 Antibody (NBP3-09592)

Learn more about PTMs related to TMEM114 Antibody (NBP3-09592).

Blogs on TMEM114

There are no specific blogs for TMEM114, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM114 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM114