TMED1 Recombinant Protein Antigen

Images

 
There are currently no images for TMED1 Protein (NBP1-81595PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMED1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMED1.

Source: E.coli

Amino Acid Sequence: PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMED1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81595.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TMED1 Recombinant Protein Antigen

  • IL1RL1-Binding Protein
  • Il1rl1l
  • IL1RL1LG
  • IL-1RL1LG
  • IL1RL1LGIL1RL1-binding protein
  • Interleukin 1 Receptor-Like 1 Ligand
  • Interleukin-1 receptor-like 1 ligand
  • Ly84l
  • MGC1270
  • P24g1
  • P24gamma1
  • Putative T1/ST2 receptor-binding protein
  • ST2L
  • T1/ST2 receptor binding protein
  • TMED1
  • Tp24
  • transmembrane emp24 domain containing 1
  • transmembrane emp24 domain-containing protein 1
  • transmembrane emp24 protein transport domain containing 1

Background

The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DST200
Species: Hu
Applications: ELISA
3626-ML/CF
Species: Mu
Applications: BA
AF5828
Species: Hu
Applications: ICC, Neut, WB
201-LB/CF
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
DY413
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
7625
Species: Mu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
DY417
Species: Mu
Applications: ELISA
AF676
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for TMED1 Protein (NBP1-81595PEP) (0)

There are no publications for TMED1 Protein (NBP1-81595PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMED1 Protein (NBP1-81595PEP) (0)

There are no reviews for TMED1 Protein (NBP1-81595PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMED1 Protein (NBP1-81595PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMED1 Products

Bioinformatics Tool for TMED1 Protein (NBP1-81595PEP)

Discover related pathways, diseases and genes to TMED1 Protein (NBP1-81595PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMED1 Protein (NBP1-81595PEP)

View related products by pathway.

Blogs on TMED1

There are no specific blogs for TMED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMED1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMED1