TMED1 Antibody

Images

 
Western Blot: TMED1 Antibody [NBP1-74215] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: TMED1 Antibody [NBP1-74215] - Human Adult heart Observed Staining: Cytoplasmic (resembles Golgi) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary ...read more
Western Blot: TMED1 Antibody [NBP1-74215] - Rat Lung Lysate 1ug/ml Gel Concentration 12%
Western Blot: TMED1 Antibody [NBP1-74215] - Antibody Titration: 1 ug/ml Human heart.
Western Blot: TMED1 Antibody [NBP1-74215] - Lanes: Lane 1 and 2: 30 ug HEK-293 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 2000 Gene name: Tmed1.

Product Details

Summary
Product Discontinued
View other related TMED1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74215
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TMED1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Tmed1. Immunizing peptide sequence EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF.
Clonality
Polyclonal
Host
Rabbit
Gene
TMED1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against Tmed1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMED1 Antibody

  • Il1rl1l
  • IL1RL1LGIL1RL1-binding protein
  • interleukin 1 receptor-like 1 ligand
  • Interleukin-1 receptor-like 1 ligand
  • MGC1270
  • Putative T1/ST2 receptor-binding protein
  • ST2L
  • T1/ST2 receptor binding protein
  • transmembrane emp24 domain containing 1
  • transmembrane emp24 domain-containing protein 1
  • transmembrane emp24 protein transport domain containing 1

Background

Tmed1 have a potential role in protein trafficking.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
AF3626
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP1-77148
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF676
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for TMED1 Antibody (NBP1-74215) (0)

There are no publications for TMED1 Antibody (NBP1-74215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMED1 Antibody (NBP1-74215) (0)

There are no reviews for TMED1 Antibody (NBP1-74215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMED1 Antibody (NBP1-74215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMED1 Products

Bioinformatics Tool for TMED1 Antibody (NBP1-74215)

Discover related pathways, diseases and genes to TMED1 Antibody (NBP1-74215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMED1 Antibody (NBP1-74215)

View related products by pathway.

Blogs on TMED1

There are no specific blogs for TMED1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMED1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMED1
Uniprot