TMED1 Antibody


Western Blot: TMED1 Antibody [NBP1-74215] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: TMED1 Antibody [NBP1-74215] - Human Adult heart Observed Staining: Cytoplasmic (resembles Golgi) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary more
Western Blot: TMED1 Antibody [NBP1-74215] - Rat Lung Lysate 1ug/ml Gel Concentration 12%
Western Blot: TMED1 Antibody [NBP1-74215] - Antibody Titration: 1 ug/ml Human heart.
Western Blot: TMED1 Antibody [NBP1-74215] - Lanes: Lane 1 and 2: 30 ug HEK-293 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 2000 Gene name: Tmed1.

Product Details

Product Discontinued
View other related TMED1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TMED1 Antibody Summary

Synthetic peptides corresponding to the N terminal of Tmed1. Immunizing peptide sequence EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against Tmed1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMED1 Antibody

  • IL1RL1-Binding Protein
  • Il1rl1l
  • IL1RL1LG
  • IL-1RL1LG
  • IL1RL1LGIL1RL1-binding protein
  • Interleukin 1 Receptor-Like 1 Ligand
  • Interleukin-1 receptor-like 1 ligand
  • Ly84l
  • MGC1270
  • P24g1
  • P24gamma1
  • Putative T1/ST2 receptor-binding protein
  • ST2L
  • T1/ST2 receptor binding protein
  • TMED1
  • Tp24
  • transmembrane emp24 domain containing 1
  • transmembrane emp24 domain-containing protein 1
  • transmembrane emp24 protein transport domain containing 1


Tmed1 have a potential role in protein trafficking.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Po
Applications: WB, IHC, IHC-P

Publications for TMED1 Antibody (NBP1-74215) (0)

There are no publications for TMED1 Antibody (NBP1-74215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMED1 Antibody (NBP1-74215) (0)

There are no reviews for TMED1 Antibody (NBP1-74215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMED1 Antibody (NBP1-74215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMED1 Products

Bioinformatics Tool for TMED1 Antibody (NBP1-74215)

Discover related pathways, diseases and genes to TMED1 Antibody (NBP1-74215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMED1 Antibody (NBP1-74215)

View related products by pathway.

Blogs on TMED1

There are no specific blogs for TMED1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMED1 Antibody and receive a gift card or discount.


Gene Symbol TMED1