TM14 Antibody

Images

 
Western Blot: TM14 Antibody [NBP2-85927] - Host: Rabbit. Target Name: FBLN7. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM14 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TM14. Peptide sequence: VMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (92%), Rat (93%), Canine (93%), Equine (93%), Zebrafish (93%), Rabbit (93%), Guinea Pig (93%), Bovine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FBLN7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TM14 Antibody

  • FBLN7
  • FIBL-7
  • Fibulin 7
  • TM14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30604
Species: Hu
Applications: IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
H00009988-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33548
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-90214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93530
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for TM14 Antibody (NBP2-85927) (0)

There are no publications for TM14 Antibody (NBP2-85927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM14 Antibody (NBP2-85927) (0)

There are no reviews for TM14 Antibody (NBP2-85927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TM14 Antibody (NBP2-85927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TM14 Products

Bioinformatics Tool for TM14 Antibody (NBP2-85927)

Discover related pathways, diseases and genes to TM14 Antibody (NBP2-85927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TM14

There are no specific blogs for TM14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLN7