TLR5 Antibody (3E4.)

Images

 
Western Blot: TLR5 Antibody (3E4) [H00007100-M02] - Western Blot detection against Immunogen (39.09 KDa).
Sandwich ELISA: TLR5 Antibody (3E4) [H00007100-M02] - Detection limit for recombinant GST tagged TLR5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TLR5 Antibody (3E4.) Summary

Immunogen
TLR5 (NP_003259 517 a.a. - 634 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
Specificity
TLR5 - toll-like receptor 5
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TLR5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Agonist

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TLR5 Antibody (3E4.)

  • MGC126430
  • MGC126431
  • SLEB1FLJ10052
  • TIL-3
  • TIL3Toll/interleukin-1 receptor-like protein 3
  • TLR5
  • toll-like receptor 5

Background

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56536
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-24917
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC-P, CyTOF-ready, Flow-IC
DDX0490P-100
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00007100-M02
Species: Hu
Applications: WB, ELISA

Publications for TLR5 Antibody (H00007100-M02) (0)

There are no publications for TLR5 Antibody (H00007100-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLR5 Antibody (H00007100-M02) (0)

There are no reviews for TLR5 Antibody (H00007100-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TLR5 Antibody (H00007100-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TLR5 Products

Bioinformatics Tool for TLR5 Antibody (H00007100-M02)

Discover related pathways, diseases and genes to TLR5 Antibody (H00007100-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLR5 Antibody (H00007100-M02)

Discover more about diseases related to TLR5 Antibody (H00007100-M02).
 

Pathways for TLR5 Antibody (H00007100-M02)

View related products by pathway.

PTMs for TLR5 Antibody (H00007100-M02)

Learn more about PTMs related to TLR5 Antibody (H00007100-M02).
 

Research Areas for TLR5 Antibody (H00007100-M02)

Find related products by research area.

Blogs on TLR5.

The role of TLR4 in breast cancer
Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation.  In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TLR5 Antibody (3E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol TLR5
Entrez
OMIM
Uniprot