TLR3 Antibody

Images

 
Western Blot: TLR3 Antibody [H00007098-A01] - Western Blot detection against Immunogen (37.11 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TLR3 Antibody Summary

Immunogen
TLR3 (NP_003256 601 a.a. - 700 a.a.) partial recombinant protein with GST tag. LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA
Specificity
TLR3 - toll-like receptor 3
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TLR3
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Agonist

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TLR3 Antibody

  • CD283 antigen
  • CD283
  • TLR3
  • toll-like receptor 3

Background

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta and pancreas, and is restricted to the dendritic subpopulation of the leukocytes. It recognizes dsRNA associated with viral infection, and induces the activation of NF-kappaB and the production of type I interferons. It may thus play a role in host defense against viruses. Use of alternative polyadenylation sites to generate different length transcripts has been noted for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24917
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC-P, CyTOF-ready, Flow-IC
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
H00007098-A01
Species: Hu
Applications: WB, ELISA

Publications for TLR3 Antibody (H00007098-A01) (0)

There are no publications for TLR3 Antibody (H00007098-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLR3 Antibody (H00007098-A01) (0)

There are no reviews for TLR3 Antibody (H00007098-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TLR3 Antibody (H00007098-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TLR3 Products

Bioinformatics Tool for TLR3 Antibody (H00007098-A01)

Discover related pathways, diseases and genes to TLR3 Antibody (H00007098-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLR3 Antibody (H00007098-A01)

Discover more about diseases related to TLR3 Antibody (H00007098-A01).
 

Pathways for TLR3 Antibody (H00007098-A01)

View related products by pathway.

PTMs for TLR3 Antibody (H00007098-A01)

Learn more about PTMs related to TLR3 Antibody (H00007098-A01).
 

Research Areas for TLR3 Antibody (H00007098-A01)

Find related products by research area.

Blogs on TLR3.

The role of STING/TMEM173 in gamma and encephalitis Herpes Simplex Virus (HSV)
Stimulator of interferon genes (STING), also known as TMEM173, promotes the production of the interferon’s IFN-alpha and IFN-beta.  STING possesses three functional domains: a cytoplasmic C-terminal tail, a central globular domain, and four N-...  Read full blog post.

TRIF/TICAM1 and mitochondrial dynamics in the innate immune response
TRIF, also known as toll like receptor adaptor molecule 1 or TICAM1, is known for its role in invading foreign pathogens as part of our innate immune response. TRIF/TICAM1 is a TIR-domain adaptor protein (toll/interleukin-1 receptor) that interacts...  Read full blog post.

The role of TLR4 in breast cancer
Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation.  In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TLR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TLR3
Entrez
OMIM
Uniprot